PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00772.1.g00130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 272aa    MW: 30231 Da    PI: 9.4686
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00772.1.g00130.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.8e-1881133355
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa +
  Zpz_sc00772.1.g00130.1.am.mk  81 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRASW 133
                                   67789**********************************************88 PP

2HD-ZIP_I/II781.6e-2581134255
                   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtk 55 
                                   kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRA + 
  Zpz_sc00772.1.g00130.1.am.mk  81 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRASWD 134
                                   9**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1760133IPR009057Homeodomain-like
SuperFamilySSF466893.12E-1772133IPR009057Homeodomain-like
PROSITE profilePS5007115.7176136IPR001356Homeobox domain
SMARTSM003896.6E-1678140IPR001356Homeobox domain
CDDcd000861.02E-1379133No hitNo description
PfamPF000462.9E-1581133IPR001356Homeobox domain
SMARTSM003407.1E-23179222IPR003106Leucine zipper, homeobox-associated
PfamPF021834.2E-10179212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGATSPSAPS GLELTMAVPG LSSSSGSEGF AGCNNNSNGG TGNSHVRVDL DMNQPASGGE  60
EEMGSVEEDE EERGGGPHRP KKLRLSKEQS RLLEESFRLN HTLTPKQKEA LAVKLKLRPR  120
QVEVWFQNRR ASWDGSWMDG WFRKNREDEA IENVTDRAPS FPCEAIGHRS SRRRRTKLKQ  180
TEMECEYLKR CFGSLTEENR RLQREVEELR AMRVAPPTVL SPHTRQPLPA SALTMCPRCE  240
RITAATGPPA ARTARSPPAA SLFHPRRPSA AF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171179RRRRTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0626883e-95BT062688.2 Zea mays full-length cDNA clone ZM_BFb0333H18 mRNA, complete cds.
GenBankEU9661903e-95EU966190.1 Zea mays clone 292384 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645561.11e-112PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-114HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-114HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0E0FQ531e-112A0A0E0FQ53_ORYNI; Uncharacterized protein
TrEMBLA0A0E0MZW61e-112A0A0E0MZW6_ORYRU; Uncharacterized protein
STRINGLOC_Os01g45570.11e-111(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-50homeobox-leucine zipper protein 17